Primary Structure of a Ribonuclease from Bovine Brain1

Authors:
Publisher website
Google Scholar
Abstract
The primary structure of a pyrimidine base-specific ribonuclease from bovine brain was determined. The sequence determined is KESAAAKFRRQHMDSGSSSSSNPNYCNQMMKRRRMTHGRCKPVNTFVHESLDDVKAVCSQKNITCKNGHPNCYQSKSTMSITDCRETGSSKYPNCAYKTSQKQKYITVACEGNPYVPVHFDGAVLLPASPVPSLPPPHRL. Although the sequence homology of this RNase with bovine pancreatic RNase A is 78.2%, it consists of 140 amino acid residues, and it is 16 amino acid residues longer than RNase A at the carboxyl terminal. In addition to an N-glycosylated long carbohydrate chain, the bovine brain RNase has two short O-glycosyiated carbohydrate chains at the 129th and the 133rd serine residues. The additional C-terminal tail of the bovine brain RNase has a unique composi tion: 6 proline, 5 hydrophobic amino acids, and two basic amino acids, arginine and histidine.