Synthesis and Antimicrobial Activity of a New Drug Based on a Retro-Analog of Cathelicidin—Polypeptide SE-33
Authors:
- 1 March 2019
- journal article
- research article
- Published by Pleiades Publishing Ltd in Russian Journal of Bioorganic Chemistry
- Vol. 45 (2) , 89-100
Abstract
— Polypeptide SE-33 (SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFF), which is a retro analog of natural antimicrobial protein cathelicidin LL-37 ([LL-37, 37 aa]), was synthesized by...Keywords
This publication has 18 references indexed in Scilit:
- The human cathelicidin LL-37 — A pore-forming antibacterial peptide and host-cell modulatorBiochimica et Biophysica Acta (BBA) - Biomembranes, 2016
- Antimicrobial PeptidesPharmaceuticals, 2013
- The New About Congenital Antimicrobial Defense of Some Epithelial Tissues – Vaginal Mucosa and Hair2012
- Cathelicidin LL-37: An Antimicrobial Peptide with a Role in Inflammatory Skin DiseaseAnnals of Dermatology, 2012
- Antimicrobial Peptides in Periodontal Innate Defense2011
- Cathelicidin LL-37: A Multitask Antimicrobial PeptideArchivum Immunologiae et Therapiae Experimentalis, 2010
- LL-37, the only human member of the cathelicidin family of antimicrobial peptidesBiochimica et Biophysica Acta (BBA) - Biomembranes, 2006
- Expression and potential function of cathelicidin antimicrobial peptides in dermatophytosis and tinea versicolorJournal of Antimicrobial Chemotherapy, 2006
- Cathelicidin Anti-Microbial Peptide Expression in Sweat, an Innate Defense System for the SkinJournal of Investigative Dermatology, 2002
- Antimicrobial Peptides in Health and DiseaseNew England Journal of Medicine, 2002